SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_015784372.1.62203 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_015784372.1.62203
Domain Number 1 Region: 65-209
Classification Level Classification E-value
Superfamily FtsH protease domain-like 7.32e-19
Family FtsH protease domain-like 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_015784372.1.62203
Sequence length 230
Comment hypothetical protein [Cyanothece sp. PCC 8802]; AA=GCF_000024045.1; RF=na; TAX=395962; STAX=395962; NAME=Cyanothece sp. PCC 8802; strain=PCC 8802; AL=Complete Genome; RT=Major
Sequence
MERTSLNLIAISVFVMTLSALLSPIFHISPFIPAVATLGILGLVSVDSLSWQSKGLTLVL
GLLSSPQERQRIIHHEAGHFLVAYCLGIPVTGYTLSAWEAFKQGQIGYGGVKFDLTLLSD
LKVQETPLIFERFFTVWMAGIAAERVIYGNAIGGEQDRQILREMMKLAGILPQNYQQKER
WAILQAKTLIEKHQDAYQSLGEMMAQGASVEDCYQGIQKKLSWQDKTEID
Download sequence
Identical sequences gi|257060634|ref|YP_003138522.1| 395962.Cyan8802_2837 WP_015784372.1.62203

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]