SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_015790741.1.40337 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_015790741.1.40337
Domain Number 1 Region: 5-184
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 2.73e-49
Family GHMP Kinase, N-terminal domain 0.00000567
Further Details:      
 
Domain Number 2 Region: 186-354
Classification Level Classification E-value
Superfamily GHMP Kinase, C-terminal domain 1.55e-39
Family Galactokinase 0.0000404
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_015790741.1.40337
Sequence length 361
Comment galactokinase [Halorhabdus utahensis]; AA=GCF_000023945.1; RF=representative genome; TAX=519442; STAX=146826; NAME=Halorhabdus utahensis DSM 12940; strain=DSM 12940; AL=Complete Genome; RT=Major
Sequence
MVDFEGDYTVRSPGRVNLIGGHTDYTLGYVMPLATDLQTRLEATESEDVHVSSTAVESSY
SFATDDLEPVEDWVDYVKGCYAILQAAGYDPGGFRGDITTKLPIGAGLSSSASLELAVMA
LLNEAYDLGLSRERMARLSQRVENDYVGVACGIMDQFAVALGQDGHALSIDTETLTYTPV
PFPDGIEILVFHTGVSRGLVESAYNQRRETVEGALEKLDVDSSKDVSEGDLHGLDPLERE
RLGYVVRENARVQRAQAALEDGEIQTFGEILLSAHRDIADHYDASCKELDFVVETALEAG
AYGARLTGAGWGGAAIAVVDTETVESVATSIEAAYREQFPEHDPHYYRIEAADGVRVTHT
G
Download sequence
Identical sequences C7NSP3
gi|257054079|ref|YP_003131912.1| 519442.Huta_3018 WP_015790741.1.40337

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]