SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_015795407.1.73754 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_015795407.1.73754
Domain Number 1 Region: 3-150
Classification Level Classification E-value
Superfamily YaeB-like 4.84e-44
Family YaeB-like 0.00026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_015795407.1.73754
Sequence length 151
Comment tRNA (N6-threonylcarbamoyladenosine(37)-N6)-methyltransferase TrmO [Catenulispora acidiphila]; AA=GCF_000024025.1; RF=representative genome; TAX=479433; STAX=304895; NAME=Catenulispora acidiphila DSM 44928; strain=DSM 44928; AL=Complete Genome; RT=Major
Sequence
MTNIIPIGQVVGGRAEPRDDDWGGEQAVIRLDDRFGPEALAGLDAFSHLEVVYQFHLVDP
EKVQTGARHPRNNTEWPLVGIFAQRGKNRPNRIGVSRCRLVKVEGRDVHVTGLDAVDGTP
VLDLKPYMAEFGPIGEVAQPEWATELMREYY
Download sequence
Identical sequences C7Q1X8
gi|256395956|ref|YP_003117520.1| 479433.Caci_6838 WP_015795407.1.73754

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]