SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_015801186.1.52053 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_015801186.1.52053
Domain Number 1 Region: 158-455
Classification Level Classification E-value
Superfamily Phase 1 flagellin 4.45e-19
Family Phase 1 flagellin 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_015801186.1.52053
Sequence length 459
Comment flagellar hook-associated protein FlgK [Actinosynnema mirum]; AA=GCF_000023245.1; RF=representative genome; TAX=446462; STAX=40567; NAME=Actinosynnema mirum DSM 43827; strain=DSM 43827; AL=Complete Genome; RT=Major
Sequence
MSSTFSGITSALGGMQAARRGLEVAGQNIANARTEGYSRQRVETAAVGGTANAAFYATPP
ATAGSVEVTGITRMADAFLEARGRTEHSKQAYLDGREEILATTEGLFDEPSDNGLQAQLT
GMWKSWTDTADNPGDSAVRNQLVVSSGVVADRLNNLAQTLGGEYNDTRGRLDSTLSEINT
GARRLADLNTAVVQAKQHGLPANELLDQRDQLALRLVELTGGTTSTGADGSLDVQLGGVS
LVSGSTARSLTLTGSATLTGAAGDPATVRWSDDASAAPLTGGSGGALLEGLTTIMPDYLA
QLDQVASKLATGVNQQHKAGFTPTGAAGGDFFSGTTAATIKVALTSGDQVATSSSATRAL
DGSNADAISALARSATGPDASYRQTVVKIGMAVQTAASRSATQASITAQVDAARQSSAGV
NLDEELTSMLTYQRSYEAAARVMSAVDSMLDTLINRTGR
Download sequence
Identical sequences C6WJS2
WP_015801186.1.52053 446462.Amir_2357 gi|256376483|ref|YP_003100143.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]