SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_015875196.1.8832 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_015875196.1.8832
Domain Number 1 Region: 2-184
Classification Level Classification E-value
Superfamily ITPase-like 4.97e-64
Family Maf-like 0.0000102
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_015875196.1.8832
Sequence length 193
Comment MULTISPECIES: septum formation protein Maf [Enterobacteriaceae]; AA=GCF_900092945.1; RF=na; TAX=573; STAX=573; NAME=Klebsiella pneumoniae; strain=PB270; AL=Scaffold; RT=Major
Sequence
MTTLYLASGSPRRQELLTQLGLAFERLVPSIEEQRQPQESAQHYVVRLAREKAQAGVAMA
TRDLPVLGADTIVILNGEVLEKPRDAEHAAAMLRLLSGHTHQVMTAVALADKQQTLDCLV
VTEVTFRRLSEQDIADYVASGEPLDKAGAYGIQGLGGCFVRKINGSYHAVVGLPLVETYE
LLSNFNSLRKGKG
Download sequence
Identical sequences A0A1B2ZR63
484021.KP1_4972 WP_015875196.1.100635 WP_015875196.1.101332 WP_015875196.1.101526 WP_015875196.1.12939 WP_015875196.1.1513 WP_015875196.1.19533 WP_015875196.1.28375 WP_015875196.1.3282 WP_015875196.1.33057 WP_015875196.1.33806 WP_015875196.1.3640 WP_015875196.1.43084 WP_015875196.1.43874 WP_015875196.1.46199 WP_015875196.1.46327 WP_015875196.1.58280 WP_015875196.1.60995 WP_015875196.1.6391 WP_015875196.1.66409 WP_015875196.1.66434 WP_015875196.1.66989 WP_015875196.1.75152 WP_015875196.1.81159 WP_015875196.1.81235 WP_015875196.1.81544 WP_015875196.1.81744 WP_015875196.1.83948 WP_015875196.1.8832 WP_015875196.1.93161 WP_015875196.1.94608 WP_015875196.1.95743 WP_015875196.1.96645 WP_015875196.1.97728 gi|238896753|ref|YP_002921498.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]