SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_015884116.1.13559 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_015884116.1.13559
Domain Number 1 Region: 5-98
Classification Level Classification E-value
Superfamily SpoIIaa-like 4.91e-17
Family Anti-sigma factor antagonist SpoIIaa 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_015884116.1.13559
Sequence length 115
Comment anti-sigma factor antagonist [Beutenbergia cavernae]; AA=GCF_000023105.1; RF=representative genome; TAX=471853; STAX=84757; NAME=Beutenbergia cavernae DSM 12333; strain=DSM 12333; AL=Complete Genome; RT=Major
Sequence
MIEISTSATSTTVTIEGDLDLSTRPQFHAATAKLGAVRRPLLVIDASRITFLDSTGAAFL
ISLADATRKRGGAAVLRGADERVLFVLETCGALDFFRLDPEPGLQEGDGGTRLRG
Download sequence
Identical sequences C5C335
gi|229822115|ref|YP_002883641.1| WP_015884116.1.13559 APC37125 471853.Bcav_3637

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]