SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_015895486.1.17207 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_015895486.1.17207
Domain Number 1 Region: 132-201
Classification Level Classification E-value
Superfamily Probable bacterial effector-binding domain 0.0000022
Family Gyrase inhibitory protein GyrI (SbmC, YeeB) 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_015895486.1.17207
Sequence length 203
Comment hypothetical protein [Gemmatimonas aurantiaca]; AA=GCF_000010305.1; RF=representative genome; TAX=379066; STAX=173480; NAME=Gemmatimonas aurantiaca T-27; strain=T-27; AL=Complete Genome; RT=Major
Sequence
MTKLDLKKDLRHLYAPSAKDVAVVDVPSMHFLMIDGEGDPNHAPAYAEAVEALFTLAYAI
KFAVKKGPAGIDYGVMPLEGLWWADDMSAFTTGDRSQWQWTMMIMQPDFVNASLVADITK
EVTRKKNPVALPLVRFEAFAEGPAAQVMHLGPFSEEGPTIERLHGFIEASGRQLAGKHHE
IYLSDIRKAAPDKWKTVVRQPLR
Download sequence
Identical sequences C1ADZ2
379066.GAU_3677 gi|226229083|ref|YP_002763189.1| WP_015895486.1.17207

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]