SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_015895972.1.62785 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_015895972.1.62785
Domain Number 1 Region: 11-97
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 1.28e-22
Family DNA-binding N-terminal domain of transcription activators 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_015895972.1.62785
Sequence length 135
Comment MerR family transcriptional regulator [Acidobacterium capsulatum]; AA=GCF_000022565.1; RF=representative genome; TAX=240015; STAX=33075; NAME=Acidobacterium capsulatum ATCC 51196; strain=ATCC 51196; AL=Complete Genome; RT=Major
Sequence
MPTKRKSKGAYMISAVAEMYDIHPQTLRLYEREGLLKPSRTEGNTRLYTDEDLERLEFIL
NLARDLGVNIAGIAIILQMRERMEEMNRQMQDFVEYVRSEMLTHMQQGFSQNSPQPGAIV
PLKRPMVVPHSRSKR
Download sequence
Identical sequences C1F2Q5
gi|225872462|ref|YP_002753917.1| WP_015895972.1.62785 240015.ACP_0804

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]