SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_015910164.1.80915 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_015910164.1.80915
Domain Number 1 Region: 4-165
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 2.73e-30
Family GHMP Kinase, N-terminal domain 0.00041
Further Details:      
 
Domain Number 2 Region: 182-326
Classification Level Classification E-value
Superfamily GHMP Kinase, C-terminal domain 1.18e-29
Family Mevalonate 5-diphosphate decarboxylase 0.092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_015910164.1.80915
Sequence length 332
Comment diphosphomevalonate decarboxylase [Halorubrum lacusprofundi]; AA=GCF_002215285.1; RF=na; TAX=2247; STAX=2247; NAME=Halorubrum lacusprofundi; strain=HLS1; AL=Scaffold; RT=Major
Sequence
MTEKATARAHPIQGLVKYHGMRDPELRLPYHDSISLCTAPTATTTTVEWQPDASEDVYVI
GDEEVDGRAAERIDMVVEHVRELAGVDAAVRLESENSFPSNIGFGSSSSGFAAAALALTE
AAGLDLTLPDISTVARRGSSSAARSVTGAYSRLDAGLNDEDCRSHRLDVGVGDDGFDPEE
DLRIVAAHVPAYKETEEAHREAAASHMMQARTAHVQDQLVEMTDALREGDFDRICGTAEH
DSLSLTATTMTGPAGWVYWQPETIAVFNAVRELREEGVPVYFSTDTGASVYVNTLAGHAE
EVEERIAEIGIDTDIWEVGGPAHLLDENEALF
Download sequence
Identical sequences B9LNT4
416348.Hlac_1434 gi|222479855|ref|YP_002566092.1| WP_015910164.1.44229 WP_015910164.1.66911 WP_015910164.1.80915

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]