SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_016490357.1.19175 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_016490357.1.19175
Domain Number 1 Region: 241-779
Classification Level Classification E-value
Superfamily Formate dehydrogenase/DMSO reductase, domains 1-3 2.62e-196
Family Formate dehydrogenase/DMSO reductase, domains 1-3 0.00000000207
Further Details:      
 
Domain Number 2 Region: 781-923
Classification Level Classification E-value
Superfamily ADC-like 5.88e-41
Family Formate dehydrogenase/DMSO reductase, C-terminal domain 0.0012
Further Details:      
 
Domain Number 3 Region: 97-236
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 4.18e-37
Family Ferredoxin domains from multidomain proteins 0.0045
Further Details:      
 
Domain Number 4 Region: 24-96
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 9.23e-19
Family 2Fe-2S ferredoxin domains from multidomain proteins 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_016490357.1.19175
Sequence length 958
Comment formate dehydrogenase subunit alpha [Pseudomonas resinovorans]; AA=GCF_000412695.1; RF=representative genome; TAX=1245471; STAX=53412; NAME=Pseudomonas resinovorans NBRC 106553; strain=NBRC 106553; AL=Complete Genome; RT=Major
Sequence
MINLFDPASDIDLGTPARDSEVQVSLSIDGREISVPAGTSVMRAAALLGTTIPKLCATDS
LEPFGSCRMCLVEIDGMRGYPASCTTPVTEGMVVHTQTPKLATLRRNVMELYISDHPLDC
LTCSANGNCELQTVAGQVGLREVRYGFDGANHLAEAKDVSNPYFDYDPSKCIVCNRCVRA
CEETQGTFALTISGRGFDSRVSAAGGEDFLDSECVSCGACVQACPTATLMEKSVVEMGQP
ERSVITTCAYCGVGCSFRAEMKGDQLVRMVPDKNGQANHGHSCVKGRFAWGYATHPDRIT
KPMIRKHLSDPWQEVSWDEAVNYAASEFRRIQLKYGRDSIGGITSSRCTNEETYLVQKLV
RAGFGNNNVDTCARVCHSPTGYGLKQTLGESAGTQSFDSVMQADVVLVIGANPTDAHPVF
GSQLKRRLRQGARLIVIDPRRIDLVDSPHARAELHLALRPGTNVAMLNALAHVIVSEGLV
NQDFVDARCEAADFARWRDFVGLPENAPEVLGPVCGVPAEQIRAAARLYATGGNAAIYYG
LGVTEHSQGSTAVMGIANLAMVTGNIGREGVGVNPLRGQNNVQGSCDMGSFPHELPGYRH
ISNEAVRHQFEQAWGVTLQPDPGLRIPNMFEAALGGTFKALYCQGEDIAQSDPNTQHVTA
ALSAMECVVVQDIFLNETAKFAHVFLPGSSFLEKDGTFTNAERRISRVRKVMDPLGGKAD
WEATVALANALGYRMDYKHPSEIMDEIARLTPTFTRVSYAELDRHGSLQWPCNDAAPDGT
PTMHIEEFARGKGRFMLTGYVPTEEKVNNRYPLLLTTGRILSQYNVGAQTRRTDNVAWHD
EDRLEIHPTDAESRGISEGDWVGVGSRAGQTVLRARVSERVAPGVVYTTFHFPESGANVI
TTDNSDWATNCPEYKVTAVEVARVYQPSEWQKRYQAFSDEQRRLLKERRRTEKAEVRR
Download sequence
Identical sequences S6AQN3
gi|512616067|ref|YP_008100751.1| WP_016490357.1.19175

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]