SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_017927201.1.36416 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_017927201.1.36416
Domain Number 1 Region: 163-273
Classification Level Classification E-value
Superfamily SpoIIaa-like 1.9e-18
Family Anti-sigma factor antagonist SpoIIaa 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_017927201.1.36416
Sequence length 293
Comment hypothetical protein [Loktanella hongkongensis]; AA=GCF_000365005.1; RF=na; TAX=1122180; STAX=278132; NAME=Loktanella hongkongensis DSM 17492; strain=UST950701-009P; AL=Scaffold; RT=Major
Sequence
MTAAPTTEVSRLLSEDFDGVLDAWFATQKRDGVRRPDLFSDRESRRQLSELLRTFSEALG
RIDISEPVDIDTEAWSELRMALSEITLVRTERGVAPWEMTAFMLALKQPVFEKLSEGLAN
TPERLLAEASDFGRVVDAFAMHINEHFIAERDEIIERQRAEMMELSTPVVQLWERVLTIP
LIGTLDSMRAQEVMENLLNSIVEHSAEVVIVDITGVRVVDTQVAQHLLRTAAAVRLMGAE
AIISGISPKIAQTMVELGVDVGEVTTRPSIRAALDEAFRRVGFRISRVEDTRV
Download sequence
Identical sequences A0A017HAF8
WP_017927201.1.16665 WP_017927201.1.36416

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]