SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_018108476.1.75192 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_018108476.1.75192
Domain Number 1 Region: 664-1119
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 3.3e-27
Family alpha-mannosidase, C-terminal domain 0.028
Further Details:      
 
Domain Number 2 Region: 268-479
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 6.67e-22
Family alpha-mannosidase 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_018108476.1.75192
Sequence length 1121
Comment hypothetical protein [Bacteroides propionicifaciens]; AA=GCF_000375405.1; RF=representative genome; TAX=1121099; STAX=392838; NAME=Bacteroides propionicifaciens DSM 19291 = JCM 14649; strain=DSM 19291; AL=Contig; RT=Major
Sequence
MKNRILLLLILTIMAPPTWAFPQKSGQLVQGYEKELSGTRISYESHVPTANEALINRTIP
ESKPIEWESQVISSTKGLTTFVFTLGVTRIKPGTQSADYHLFLNGDKLITFNLTSNNQWV
VKGIKESSFEFEQYYKDARDDLFGYAFLTIPSKYLEADKPVTFKISSDKSDKNDWLMVFK
TPIQDSVEALATQTVLKHSKKQIIQITYSHFDKPGKVRLDFNNISITEPAKFGINHYQLA
IDPINKKASYPLSIANNGAKVKTTVNFSPYRNWKVNFVQHTHTDIGYTRPQHEILSEHMR
FIDYALDYCDQTDDYPEDAKFRFTLETSWSVSEYLRTRPKEQVERLKRRIKEGRIEATAM
YFNFDELPSENDLTNSLYPLEVFKQEDIKVQTAMQNDVNGVGWNFAETLPDLGIKYLIMG
THGHKALISFDIPTAFWWESPSGKKMLAYRAEHYNHGNFLQIEKGNFENFEKRMLKYLED
LAAKNYPHDIASAQYSGYFTDNSPPSIAGSEIVKMWNEKYEYPKLRIPIASEFMEEIEKN
YANELDTYCVAWPDWWTDGFGSAAREVAFYRYAQSDIISNEVMLSLAKILGAKLSPTLDN
EIAEANKALLFYGEHTFGFHASVREPFNKETMQQRSHKGAYAWESYRRTRPIGETALGLM
QSYVPRQKDNASIIVFNPMSWHHSGVTTIYADHEVLPINQETIIRDHNGKEVKKQIVRSY
ADASYWDIWVDDIAPLGSMYYTIEHSKKSPNSKSATYEFSGSIENQWYSIEVDTKSGTIT
KWYDKELGQNLLSDQPEWKMGELIYETDDVRGALDQFKPGNFKHYSPTNVRFASFQEGDI
WDTYKFIGTTPAGMGEDNFTVELQVFKTAKQINLTYLLNKKLVTDPEAVYVSFPFELTDG
KIFFDVAGGSIQAGVDQLPGSANDWNTVQSFASVRNKDAQILIASKEIPLMQFGNINLGR
FKAGATPETNHIFTWPMNNYWVTNFNADQHGEFEWTYQLTSSKDNSDELANKFGWGTRLP
LPNRVIPSGVQKEGKLKDGSMLNFSAENLLLISMKPTTDANAVVLHIREITGKETNFTVS
SDYVSDIKLSACDPFGKPLTDKIEKSINIKPYEGKFIKLYF
Download sequence
Identical sequences WP_018108476.1.20202 WP_018108476.1.75192

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]