SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_018615562.1.15167 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_018615562.1.15167
Domain Number 1 Region: 546-813,849-951
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 6.12e-34
Family alpha-mannosidase, C-terminal domain 0.02
Further Details:      
 
Domain Number 2 Region: 125-313
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 0.0000000000000526
Family alpha-mannosidase 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_018615562.1.15167
Sequence length 974
Comment hypothetical protein [Segetibacter koreensis]; AA=GCF_000374045.1; RF=representative genome; TAX=1123248; STAX=398037; NAME=Segetibacter koreensis DSM 18137; strain=DSM 18137; AL=Scaffold; RT=Major
Sequence
MQLVLFFKRNILMQQLKFLFIIILLAGNVKMHAQTHQVFTDIELQPTVAYINYKGHECRM
IRLLFKNGKSYSDLKVNISFNGLSDSISLPADAAGIEAFEVPLPGPPIAKNTQASIEIES
AEKYLASRCIVEPAKKWTVYILPHSHVDVGYTNLQSKVLKLHMNNIDEAIALAAKTQNYP
EGAKYKWNTEAVWVVDNYLKNVDSTKKSLFWDAVKKGWINIDAAYGNINTSLTDSRQLMQ
MFHTGKQLGKEHGIDIETMFQGDVPGSSWGLAAQVNQTGIKYFLSGPNASDRIGTTANWQ
DKPFYWLSPSGTQKLLFWQCQPYSIGYTLKGSKIPNFFKVDEPKAFYTGHPSDNFLNPYL
FQYLNKLSDESFPYDMTILTWAMSDNAPIDPELPDAVKLWNERYTSPRLVITSTKQFFAD
FEKKYKNEIPVLKGDYTEYWTDGVGSAAKETAINRNTSSELQQADALWAIRNKSPYPKNK
FEETWKNILLFSEHTWGAYNSISEPENPKVKEEWKIKQRFALNGKKQADELLQLATQDVQ
AISNAIDLYNTSSWTRTELVKVPANLSTAGDLVKDIRGHKIVSQRLSTGELAFMATDIPA
LAKGRYTINSGKSYFKGNPVKITSNTISNDIYTVELNPQTGTIKKLLSKISGRNFVSEDS
VTFNQYLYLLGDSLKNIQTSSNPVITIKENGPLVASLLVKSSAPGCNSLMQEIRLITGSD
KIEIINTVDKKAVLKKEGVHFAFPFNIPKPQLRYNIPWASVLNGFDQLPNANKNWYAMQR
WLDISNKEYGITISSPDAPLFEIGNVTAHLLGGLHNSPLWIKEQPTSSRIYSWVMNNHWH
TNFVAFQEGVVSFRYFIKAHEKAYNAFSANLFGIENHKPLIVAKAAGKAGEKLFFSVNGH
THVFVESMKPSAAGKGVIMQLVNTSNRAENVTINSRADKTIHIWTTNILEEKLRAMPTTF
SISGKDNLSVRVEE
Download sequence
Identical sequences WP_018615562.1.15167

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]