SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_018655329.1.19293 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_018655329.1.19293
Domain Number 1 Region: 565-1028
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 5.02e-20
Family alpha-mannosidase, C-terminal domain 0.052
Further Details:      
 
Domain Number 2 Region: 126-323
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 1.28e-17
Family alpha-mannosidase 0.069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_018655329.1.19293
Sequence length 1038
Comment hypothetical protein [Actinomadura flavalba]; AA=GCF_000374305.1; RF=representative genome; TAX=561175; STAX=1120938; NAME=Actinomadura flavalba DSM 45200; strain=DSM 45200; AL=Scaffold; RT=Major
Sequence
MTATMTSRLLQESLGSPDYDRIRAALREDTSAEVLAVRGLAVRAAVLPLFRRDDAGTLRQ
AVRITVTGGPAAGLRLTLREPGGPPVDAANPDGSGTATLLVPEVDATRRLTLEVHDDAGL
VGAAPVDVTPQRKWTVFVVHHSHLDIGYTDPQATVLRHHLDYLDAAVRLSRETADWPDDA
RFRWSVESSLPALRWLATRPADAVAEFAASARAGQIEVTAFPMQLHTEACSDEELYRQLR
HVAGLRERHGIDVRSAMHTDIPGAVVGVVDALSAAGVRYLSAAHNWAGRSVPYVTGGDRL
ARPFRWRAPSGRELLVWFTDTPHGMAYMEGNTVGLVDGYDLTEDLLPRYLRALSDSPYPY
GPGTFGWYAAPGQVGAAKAPDALDAVHLRVQGAHADNAGPSLLPASIARRWNETWAYPRV
RTATNSDFFEHVEREHGDRLDTHEGDWTDWWADGLGSGARPLGYVRRAQSLLRTAETLHA
FADARSGETTGAADAIDAAYDDAAMFDEHTWGAANPWEDAEEAGDSGGLQWGHKSAFAYR
AHDAAHELVNTAAYRFGATFAAGEGAPASFVVVNPGTAARTDVVRAFLPRDVVAVDVPVR
LVDARTGEDIAHHEVEVDPAEWPTRPIGRHLSAVLADVPGHGHVRVDVVRADAPAPVPAE
LDGTVVENEFYRVEYDTRRGHIASVFDKRAGRELVAADAAGGFGQYVYDRYATAPHFNHL
SGHVLVHDTALLGDRAIGGAATVVTAERTPVGERLVVEQHAKGVDWIRTTIELYAGVPRL
DLTHRIAKQPTPAKEAVFFAFPFAVPDAPAAWELTGGVGGTAVPSVPGSAEHMRPIRHWV
AFEDPALTVAWATLEAPLVQFGSIHMPYAPFPPTLGEEPGTLYSWALNNIWDTNFPSQQQ
GETTFRYAVASAAPQDAGSGRRLGAVTAAGLTDAFVATLATGPGTAEADGVLVTADDPDV
LVTSVGRSRHGHDLLVRLRSLASGPVETTLTVPGARRAWASAGLEHDPDELPVRDGAVTV
RLPGCGIAVVAVALDGAA
Download sequence
Identical sequences WP_018655329.1.19293

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]