SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_019129634.1.14532 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_019129634.1.14532
Domain Number 1 Region: 113-196
Classification Level Classification E-value
Superfamily PKD domain 7.72e-16
Family PKD domain 0.0029
Further Details:      
 
Domain Number 2 Region: 201-409,490-600
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.000000000000204
Family Quinoprotein alcohol dehydrogenase-like 0.0067
Further Details:      
 
Domain Number 3 Region: 28-111
Classification Level Classification E-value
Superfamily PKD domain 0.0000000000641
Family PKD domain 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_019129634.1.14532
Sequence length 633
Comment PKD domain-containing protein [Alistipes obesi]; AA=GCF_000311925.1; RF=representative genome; TAX=1118061; STAX=1118061; NAME=Alistipes obesi; AL=Scaffold; RT=Major
Sequence
MKRYIYMIAAFALMGAVSCQPDEEVAVHASFTTDKESYDVGDPVVLTNTSTAENALIAIC
KWELGKGVVSYETTPENISYDQAGEYVIKLTVTSDRGAKKSSFEKTILVVDNNIRPVADF
SWSPEKVVAGEPVQFTDRSTDEDGEVVAWEWKFGTTTSDKQNPEFTFAAQGPTEVSLTVT
DDKKGKNTKTVTIDVGRGTINLDLLWSYPYDDTKDAYVFGTSPAVSPDGEYVYVTSTGYS
LVCFTKAGERLWAFDIGKDGASAENNSGSIKVQSPTPSVGGDGTVYALAGFNEPNKGAGG
SAFYAISGGAAGGSQLWYVNTGVNTSFRFLSPAVTEKYLFIVARNVPSGHQNFQVYDKSS
GNLVDERHVNSGSYGGVLPLKNGMVIAGTGGSHGMRVYFPDGTGKWKFSCVKSNGREHNY
GGTGEDKTCEAPNGTQPASGPGGKVYILFQNQGVRADKSLGGGIVYCYDPAKTVYGQTPE
PDWYCPVKGDCAQSGMGVALGEDGTVYAATQKTGSEAAHVTAISAQGVKRWEHAADGDIN
GVPAVDDQGFVYYNDRTTGKLVKLRPEDGSRVAEIKLADELRSSPTISYDGTIYVNGMKD
DKPTVFAVKGAAEGCAASWSQQGGNPSKTEYMY
Download sequence
Identical sequences WP_019129634.1.14532

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]