SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_019130093.1.14532 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_019130093.1.14532
Domain Number 1 Region: 123-208
Classification Level Classification E-value
Superfamily PKD domain 1.96e-22
Family PKD domain 0.0022
Further Details:      
 
Domain Number 2 Region: 210-388,444-553
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 2.49e-16
Family Quinoprotein alcohol dehydrogenase-like 0.0033
Further Details:      
 
Domain Number 3 Region: 43-122
Classification Level Classification E-value
Superfamily PKD domain 0.0000000017
Family PKD domain 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_019130093.1.14532
Sequence length 620
Comment hypothetical protein [Alistipes obesi]; AA=GCF_000311925.1; RF=representative genome; TAX=1118061; STAX=1118061; NAME=Alistipes obesi; AL=Scaffold; RT=Major
Sequence
MKRILSILSVATLFVLIGCTDSNDDMEIVYDSIIEPDFTVAAAEIVAGVTPVTFTNTTSV
EGTTVAEYFWHFGFSGEGNWSEEAEPDPIVYNQAGEYTVTLTAWGADGNRATVKKVVTVL
ADNVVPTADFSYSPMMVNVGDEVTFTDKSTDSDGEIVSREWVFPDGSTSTETNPSYTFTQ
KGMFQVKLTVADDRGGESSATKSINVRDGDVSDFTLLWSTEVASADALCDANVVTVSDLG
YVYAVTGDGKLVALDAEGAVAWEYDAAAQDKVNLRKEIAYPSVDADGTVYWVAHAYGDDS
AVPTVYAFEGSTGSVLWKNQTAYAAGARIAFSTPSVGPNMVVVGSRGTNGAIRGFEKSSG
RNTAQATPANGGGTSGTIVLKNGVVIFTNTGEYGYGIMVPDDQFVWSPVPTADTFAPGKT
LSAGRCQPCVGADNCVYLPGKIKEGSGGSWNIACFDCTNLTASSTKTPKWSAAVPDGFVQ
GGASLSADGQTLYIVADAATPSTVYALSTSNGSTVWSYPLDAHCNSVPAVDNLGQVHVAT
ETGHYVVLSPDGKPVYDEQIADMFEGSVSISEWGYSYVLGKDASAGKLKVYAVALPGVNS
AAASAWSQYGRNARHINYQQ
Download sequence
Identical sequences WP_019130093.1.14532

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]