SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_019337996.1.36422 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_019337996.1.36422
Domain Number 1 Region: 1-251
Classification Level Classification E-value
Superfamily Thiolase-like 1.12e-63
Family Thiolase-related 0.000000144
Further Details:      
 
Domain Number 2 Region: 213-400
Classification Level Classification E-value
Superfamily Thiolase-like 3.17e-59
Family Thiolase-related 0.00000172
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_019337996.1.36422
Sequence length 402
Comment beta-ketoacyl-[acyl-carrier-protein] synthase I [Stenotrophomonas maltophilia]; AA=GCF_001071655.1; RF=na; TAX=40324; STAX=40324; NAME=Stenotrophomonas maltophilia; strain=179_SMAL; AL=Scaffold; RT=Major
Sequence
MRRVVITGMGITSCLGNDLDTVSAALREGRSGITALADHAEAGLRSQVGGRVDLDLEALI
DRKQKRFMSDAAAFAYLAMRDAIADAGLSAEQVSNLRTGLIAGSGGGSSEWQIGAVDLLR
ERGVRKVGPYMVPRTMCSTVSACLATAYQIKGVSYSLSAACATSAHCIGAAADMIRHGAQ
DIMFAGGGEDLHWSMSVMFDAMGALSTSFNETPASASRPYDKDRDGFVIAGGGGMLVLED
YDHAVARGAHIHAELIGYGVTSDGADMVAPSGEGAVRCMKMALQGVDRPLDYLNTHGTST
PLGDVTELNAIREVFGDAVPPLSSTKALSGHSLGAASVHEAIYCLLMMRDGFVAGSANIG
ELDPKVESFPILRESREQKLDTVMSNSFGFGGTNAALVFGRV
Download sequence
Identical sequences WP_019337996.1.11095 WP_019337996.1.36422 WP_019337996.1.89178 WP_019337996.1.96337 jgi|PhycaF7|120290|estExt_fgenesh1_pm.C_50337

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]