SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_019436609.1.42045 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_019436609.1.42045
Domain Number 1 Region: 1-263
Classification Level Classification E-value
Superfamily ClpP/crotonase 1.19e-85
Family Crotonase-like 0.0000633
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_019436609.1.42045
Sequence length 263
Comment MULTISPECIES: 2-(1,2-epoxy-1,2-dihydrophenyl)acetyl-CoA isomerase [Pseudomonas]; AA=GCF_000495455.2; RF=na; TAX=1215087; STAX=303; NAME=Pseudomonas putida S12; strain=S12; AL=Complete Genome; RT=Major
Sequence
MTFEHILFSVEAGVATLSLNRPEQLNSFNAAMHGEVREALKRVRQNPEVRVLLLTGEGRG
FCAGQDLADRNVAPGAEAPDLGESIEKFYNPLIRTLRDLPLPVICAVNGVAAGAGANIPL
ACDLVLAARSASFIQAFCKIGLIPDSGGTWSLPRLVGLARAKALALLGERLTAEQAEQWG
LIYRVVDDAELRDEALKLARHLATQPTYGLALIKRSLNASLNNDFDAQLDLERDLQCLAG
RSEDYREGVAAFMAKRTPVFKGR
Download sequence
Identical sequences Q845K1 U5VQV9 V4GGZ3
gi|557225954|ref|YP_008766168.1|NC_022739 gi|557225954|ref|YP_008766168.1| WP_019436609.1.42045 WP_019436609.1.48025 WP_019436609.1.72310

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]