SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_020458357.1.9268 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_020458357.1.9268
Domain Number 1 Region: 5-87
Classification Level Classification E-value
Superfamily Homeodomain-like 4.82e-17
Family Tetracyclin repressor-like, N-terminal domain 0.0054
Further Details:      
 
Weak hits

Sequence:  WP_020458357.1.9268
Domain Number - Region: 86-166
Classification Level Classification E-value
Superfamily Tetracyclin repressor-like, C-terminal domain 0.0786
Family Tetracyclin repressor-like, C-terminal domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_020458357.1.9268
Sequence length 210
Comment TetR family transcriptional regulator [Frankia sp. EAN1pec]; AA=GCF_000018005.1; RF=na; TAX=298653; STAX=298653; NAME=Frankia sp. EAN1pec; strain=EAN1.pec; AL=Complete Genome; RT=Major
Sequence
MTSPRRVGAVTSKTRALLLDCAENLMLEQGYAAVTYRGVAAQAGVTAGLVQYYFPTLDDL
LVALVRRGIEHSLARLATSLETSPPLRAVWEHAGDRTRAALMAEFMALANHHKTIRTELA
KAGEQTRELALAAVSERSSDYGRTAEKTSPEALVFLMISTPRMIAMEETIGLSTFHAETI
DFIERYLDRIEPRAANSDRGPKPSPATTRE
Download sequence
Identical sequences A8KZT0
298653.Franean1_0706 WP_020458357.1.9268 gi|158312562|ref|YP_001505070.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]