SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_020459396.1.9268 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_020459396.1.9268
Domain Number 1 Region: 25-91
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000000000135
Family Tetracyclin repressor-like, N-terminal domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_020459396.1.9268
Sequence length 219
Comment TetR/AcrR family transcriptional regulator [Frankia sp. EAN1pec]; AA=GCF_000018005.1; RF=na; TAX=298653; STAX=298653; NAME=Frankia sp. EAN1pec; strain=EAN1.pec; AL=Complete Genome; RT=Major
Sequence
MSLPADQHADGSDPARQTRRYDSPVRRAQTAQTRERIVAAGTALVHSFPTWDWRGLTFRA
VAERAGVSKRTVHRYFATESELHDAILRNLEKEAGVVYEGLDLDNLADTAAGGLATLDRF
AASPGLSGEAVEPTLAADRRRREALARAVAPPTAEWTDTQRRMAAAILDILWTGHVYERL
VTAWKLDLDAATGAVTWALDLLADGIREDHRPQPRPPAR
Download sequence
Identical sequences A8LFC3
WP_020459396.1.9268 298653.Franean1_1788 gi|158313624|ref|YP_001506132.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]