SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_020460433.1.9268 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_020460433.1.9268
Domain Number 1 Region: 2-80
Classification Level Classification E-value
Superfamily Class I glutamine amidotransferase-like 1.92e-20
Family DJ-1/PfpI 0.015
Further Details:      
 
Domain Number 2 Region: 151-201
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000000000717
Family AraC type transcriptional activator 0.059
Further Details:      
 
Domain Number 3 Region: 103-148
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0000000179
Family AraC type transcriptional activator 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_020460433.1.9268
Sequence length 258
Comment AraC family transcriptional regulator [Frankia sp. EAN1pec]; AA=GCF_000018005.1; RF=na; TAX=298653; STAX=298653; NAME=Frankia sp. EAN1pec; strain=EAN1.pec; AL=Complete Genome; RT=Major
Sequence
MTGLLDGRPAATHWNHAATFSREFPAVRLDSDVLFVDDGDVLTSAGAASGVDLCLHLIRL
DQGSEVANAVARACIVAPWREGGQAQFIEAPVPDSGDASTAATREWALRRLDAGLTLASM
ARHASMSIRTFTRRFRDETGTSPNQWLTRQRIDYARRLLESTDLSIDQIADATGFGTAAS
LRGHLRNAIGVSPSAYRRTFHLRAHTGERTTTRSSASGEPGRGGDAVVLDDEPVGPQPDT
EGTAAFRGAGARQIPSIS
Download sequence
Identical sequences A8L9D9
gi|158314676|ref|YP_001507184.1| 298653.Franean1_2855 WP_020460433.1.9268

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]