SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_020462406.1.9268 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_020462406.1.9268
Domain Number 1 Region: 93-197
Classification Level Classification E-value
Superfamily Tetracyclin repressor-like, C-terminal domain 2.45e-17
Family Tetracyclin repressor-like, C-terminal domain 0.0069
Further Details:      
 
Domain Number 2 Region: 12-77
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000000000000446
Family Tetracyclin repressor-like, N-terminal domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_020462406.1.9268
Sequence length 216
Comment TetR family transcriptional regulator [Frankia sp. EAN1pec]; AA=GCF_000018005.1; RF=na; TAX=298653; STAX=298653; NAME=Frankia sp. EAN1pec; strain=EAN1.pec; AL=Complete Genome; RT=Major
Sequence
MVDTAYVTGEGALRRRLVEVGTAMLDEGGTAAVSLRAIARQAGVSHGAPRRHFPTHAALL
AAIAAEGLADLASRLAGVRAAGEAAGASPHECVVDAGSAYVRFARERPAMFELMFRHDIL
VGAGENLRERSLPLFDAWTDLVRAALPAPPAGAGAGAGADPPEQVRRRALLAWTHLHGIA
VLAANESLGLVTASPDPTELVVEAIGVHLCPDAGPR
Download sequence
Identical sequences A8LH99
WP_020462406.1.9268 298653.Franean1_4924 gi|158316687|ref|YP_001509195.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]