SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_020462894.1.9268 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_020462894.1.9268
Domain Number 1 Region: 1-207
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.81e-44
Family Thioltransferase 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_020462894.1.9268
Sequence length 213
Comment DsbA family oxidoreductase [Frankia sp. EAN1pec]; AA=GCF_000018005.1; RF=na; TAX=298653; STAX=298653; NAME=Frankia sp. EAN1pec; strain=EAN1.pec; AL=Complete Genome; RT=Major
Sequence
MKVEVWSDIVCPWCYIGKRRLEKALTRYEHADEVEVVWRSFQLDPTQPRGENIPTSEMLA
RKYGVTPPEAKAMNDRVSALAAEEDLTYHLDRAVTANTFDAHRLIHFAATHNLAGATQER
LMRATLTDGAAVDDTDTLVRLATEAGLPADRTREVLDGDAHADDVHDDIRQARALGISGV
PFYAVDRTYGISGAQPVETILDALRRASSPVAS
Download sequence
Identical sequences A8L3F7
WP_020462894.1.9268 298653.Franean1_5431 gi|158317184|ref|YP_001509692.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]