SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_020463092.1.9268 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_020463092.1.9268
Domain Number 1 Region: 17-79
Classification Level Classification E-value
Superfamily Homeodomain-like 7.48e-18
Family Tetracyclin repressor-like, N-terminal domain 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_020463092.1.9268
Sequence length 220
Comment TetR family transcriptional regulator [Frankia sp. EAN1pec]; AA=GCF_000018005.1; RF=na; TAX=298653; STAX=298653; NAME=Frankia sp. EAN1pec; strain=EAN1.pec; AL=Complete Genome; RT=Major
Sequence
MSDSVKDGPSRVKDKPSRAEKTRLTRRRIVAAAAELFLDQGYGATTLDQVAARAGVAVQT
VYFHFGNKATLLKEALDVAAVGDDEPVALLDRPWLEELTAEPDPVRVIELWTHGGREIMG
RVAPLLAVVRGTVGTDPDLAAQWDVNEGQRRVAFRALAGLLADRAALRPGLTVEDAADLA
FLITSAENYIVATGTLGWSPERWRSTTATLLARALLGGTA
Download sequence
Identical sequences A8L631
gi|158317386|ref|YP_001509894.1| 298653.Franean1_5637 WP_020463092.1.9268

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]