SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_020464268.1.9268 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_020464268.1.9268
Domain Number 1 Region: 240-508
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 5.89e-61
Family PFOR Pyr module 0.064
Further Details:      
 
Domain Number 2 Region: 21-223
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 4.45e-24
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.011
Further Details:      
 
Domain Number 3 Region: 528-627
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 0.0000000000188
Family Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_020464268.1.9268
Sequence length 670
Comment 2-oxoglutarate ferredoxin oxidoreductase subunit alpha [Frankia sp. EAN1pec]; AA=GCF_000018005.1; RF=na; TAX=298653; STAX=298653; NAME=Frankia sp. EAN1pec; strain=EAN1.pec; AL=Complete Genome; RT=Major
Sequence
MTTELFEQPESRVRRLKGVVIRFAGDSGDGMQLTGDRFGAQAAEAGNDVATLPDFPAEIR
APAGTVGGVSSYQLHVADHDITTPGDQPDVLVAMNPAALKATLKDLRPGGVLIVDSGAFN
VRSLEKAGYDSDPLTDGSLGNYIVHAVDLTGLAVGATDGLGLKRKDAARTKNMFALGLVS
WMFNQGTESTVAYLEKRFAKKPPEILAGNLAALKAGVNYGDTTEAFAVSYEVKPAALPPG
TYRHMRGNKAIAFGLVAAAHQAGMPLFLGAYPITPATDVLHELSKLTSHDVRHFQAEDEI
AAIGAAIGGSFAGMLGVTVTSGPGMALKSEAIGLAISLELPLVIVNVQRGGPSTGLPTKT
EQSDLLQALYGRHGEAPLPVLAAQSPADCFDAAFEAAQIALERRTPVILLSDSYIANGSE
PWKVPAVEELPELGIEFATAPNAVGKDGKPAFHPYARDPRTLARPLAIPGTPGLEHRIGG
LEKADGSGELSHDADNHDLMVRTRQNKVDGVKVPALEVDDPSGAPGFGARVLVVGWGSTY
GPIGAACRLVRDQGLAIAQAHLRYLNPLPANLAAVLSSYDTVLVPEMNLGQLSGLLRMQC
GVETVGYTQTRGLPFRAVELAAVFTRLVHGADLGDTEITSEDIKAAGGASTLGMSELGRS
ELGSDSEAGK
Download sequence
Identical sequences A8L2B0
298653.Franean1_6867 WP_020464268.1.9268 gi|158318599|ref|YP_001511107.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]