SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_020464441.1.9268 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_020464441.1.9268
Domain Number 1 Region: 3-90
Classification Level Classification E-value
Superfamily Homeodomain-like 3.05e-19
Family Cgl2762-like 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_020464441.1.9268
Sequence length 98
Comment transposase [Frankia sp. EAN1pec]; AA=GCF_000018005.1; RF=na; TAX=298653; STAX=298653; NAME=Frankia sp. EAN1pec; strain=EAN1.pec; AL=Complete Genome; RT=Major
Sequence
MESRRRFDREFKEGAVRIVLETEKPVAAVARDLGVHEATLGNWVNAARRREKKGELSEDE
RVELERLRAENARLTMERDVLKRSVALWVNEAMGRTAR
Download sequence
Identical sequences A8L4X6
298653.Franean1_7044 gi|158318773|ref|YP_001511281.1| 2005205847 WP_020464441.1.9268

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]