SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_020912282.1.101980 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_020912282.1.101980
Domain Number 1 Region: 1-107
Classification Level Classification E-value
Superfamily SpoIIaa-like 5.49e-21
Family Anti-sigma factor antagonist SpoIIaa 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_020912282.1.101980
Sequence length 110
Comment Antisigma-factor antagonist (STAS) domain protein [Shewanella piezotolerans]; AA=GCF_000014885.1; RF=representative genome; TAX=225849; STAX=404011; NAME=Shewanella piezotolerans WP3; strain=WP3; AL=Complete Genome; RT=Major
Sequence
MQFDIIEKGQYTIVQINEGRFDAKLAPAFREQLEQIKGNIREHLVLDLGEVRFMDSSGLG
AVMGAYKMLRNTKISIVNPQKPVTDLLKLTRMDKLILSHPTIEDALAPTA
Download sequence
Identical sequences B8CLZ6
WP_020912282.1.101980 gi|212634982|ref|YP_002311507.1| 225849.swp_2169

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]