SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_020938293.1.98377 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_020938293.1.98377
Domain Number - Region: 95-128
Classification Level Classification E-value
Superfamily Apolipoprotein 0.00445
Family Apolipoprotein 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_020938293.1.98377
Sequence length 187
Comment hypothetical protein [Streptomyces collinus]; AA=GCF_000444875.1; RF=representative genome; TAX=1214242; STAX=42684; NAME=Streptomyces collinus Tu 365; strain=Tu 365; AL=Complete Genome; RT=Major
Sequence
MGHGGNVIHELTTDHREVEEIFGRFEALPPGSKERKLLADQATIELVRHSVAEEAYLYPA
VRKHVKGGDALADKELEDHAEAEQIMKDIEGLDADDPQFDTLMTRLMSEIRSHVEDEEQN
LFPMLQAACSPEALDELGDKVRRAKKTAPTRPHPTAPDKPPANKMLAPGAGLVDRLRDAM
SGRGKEG
Download sequence
Identical sequences S5UXR6
gi|529223799|ref|YP_008384620.1| WP_020938293.1.98377

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]