SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_020940715.1.98377 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_020940715.1.98377
Domain Number 1 Region: 11-210
Classification Level Classification E-value
Superfamily SIS domain 3.78e-20
Family mono-SIS domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_020940715.1.98377
Sequence length 251
Comment SIS domain-containing protein [Streptomyces collinus]; AA=GCF_000444875.1; RF=representative genome; TAX=1214242; STAX=42684; NAME=Streptomyces collinus Tu 365; strain=Tu 365; AL=Complete Genome; RT=Major
Sequence
MSDGTPADLFFDAAIGLLQRVREEEAEAITAAGTLLADTVAAGGRLFAFGAGHSSLAAQD
VVYRAGGLALMNLLTVPGVVGVDVTPATLGSALERVDGLASAVLDTSPLRAGDTLVIISL
SGRNALPVEMALGARALGVKVVGVTSVAYATETSSRHSSGTFLRDHCDIVLDSKIAVGDA
ELTLDTIPAPFAPASTVVTSALMQAVMATAAAALADRGIEPPLLRSGNVDGGHDWNGRVM
TEYGDRIFYRH
Download sequence
Identical sequences S5VI77
gi|529226237|ref|YP_008387058.1| WP_020940715.1.98377

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]