SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_020961862.1.66495 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_020961862.1.66495
Domain Number 1 Region: 25-172
Classification Level Classification E-value
Superfamily Acid phosphatase/Vanadium-dependent haloperoxidase 1.96e-27
Family Haloperoxidase (bromoperoxidase) 0.091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_020961862.1.66495
Sequence length 283
Comment MULTISPECIES: hypothetical protein [Thermofilum]; AA=GCF_000813245.1; RF=na; TAX=697581; STAX=1483572; NAME=Thermofilum carboxyditrophus 1505; strain=1505; AL=Complete Genome; RT=Major
Sequence
MKTKHILIIIAVLLAVSPLLGLLLGKWVDYWRIATNLGDEPAYIALTILLFYLVDPHLGV
NVLIALSTGAWLDVFMKNLFKLPRPPSELWLAPAEGYGFPSGHATTSTTFWTSLSLETRR
REVYLLGAVTVAIVCLSRIILNVHYPVDVAGGVVLGLFSSFSVYYATRKITLKPWLASLA
LALYGVAVSVLTFVQGDLNFVRLGGLLVGLAVYPLIREKINLRKESFLTKTILALVALVL
AFGFTQVAKSQAPLPQFILYLATGSITVSLPLLRSKSGRKTTG
Download sequence
Identical sequences S5ZUD4
gi|530779769|ref|YP_008431568.1| WP_020961862.1.19067 WP_020961862.1.66495

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]