SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_021753687.1.46596 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_021753687.1.46596
Domain Number - Region: 27-84
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0262
Family Capz alpha-1 subunit 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_021753687.1.46596
Sequence length 132
Comment hypothetical protein [Gemella bergeri]; AA=GCF_000469465.1; RF=representative genome; TAX=1321820; STAX=84136; NAME=Gemella bergeriae ATCC 700627; strain=ATCC 700627; AL=Scaffold; RT=Major
Sequence
MLLNVWSHVANFSILLAYVSIYLTYRTFKNTKNIQIQINKNTNRLLLLKDKEELISSLEN
YIKLIKEQSNDFQLWKNDIYATLVDIETSHGEILNCANEEYSSYFKKRYIDNQETIRLLT
KLKNSIKKECSI
Download sequence
Identical sequences U2QMG1
WP_021753687.1.46596

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]