SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_022550829.1.79392 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_022550829.1.79392
Domain Number 1 Region: 3-247
Classification Level Classification E-value
Superfamily CutC-like 5.75e-68
Family CutC-like 0.0000106
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_022550829.1.79392
Sequence length 249
Comment copper homeostasis protein CutC [Vibrio nigripulchritudo]; AA=GCF_000723605.1; RF=na; TAX=1238451; STAX=28173; NAME=Vibrio nigripulchritudo Wn13; strain=Wn13; AL=Scaffold; RT=Major
Sequence
MDMEIEVSIGNIESLYSAIAGGATRIELCSALALGGLTPSYGLMQQAGRISSIPVYAIIR
PRQGDFFYSEDEIDIMMSDITCAKQAGLQGVVLGALTSTGHIHMQHARKLCDYAHQLELG
VTFHRAFDHCNNAEKGLEDIISLGCERVLTSGLAATAPLGTNTVASLVQQAGDRISIMAG
AGVNAGNAKDLAAKTRVKELHLSGKTTRPTKMMFTSEHSKMGANDIDDYQIPVTDKAAIS
EIVHLFKSK
Download sequence
Identical sequences U4KFM5
gi|549689365|ref|YP_008621097.1| WP_022550829.1.100974 WP_022550829.1.41471 WP_022550829.1.79392 WP_022550829.1.83433 WP_022550829.1.85604 WP_022550829.1.99411

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]