SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_022772125.1.16511 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_022772125.1.16511
Domain Number 1 Region: 198-336
Classification Level Classification E-value
Superfamily CBS-domain pair 2.15e-20
Family CBS-domain pair 0.0067
Further Details:      
 
Domain Number 2 Region: 346-433
Classification Level Classification E-value
Superfamily FAD-binding/transporter-associated domain-like 5.18e-19
Family CorC/HlyC domain-like 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_022772125.1.16511
Sequence length 436
Comment hemolysin-like protein [Candidatus Symbiobacter mobilis]; AA=GCF_000477435.1; RF=na; TAX=946483; STAX=1436290; NAME=Candidatus Symbiobacter mobilis CR; strain=CR; AL=Complete Genome; RT=Major
Sequence
MEVLLILLLIVLNGLFAMTELALAACRRARLSALAAEGDRGARAALELLDQPDQFLSTIQ
IGITSIGVLNGIIGEAAFSPQFAAWMCSLGTPDAIAHVVATGLVVTIVTFLTIVCGELVP
KRIGQLYPETVSRWMSQPMQWLARIARPFVSLLAQSTAAMLRLLRIDTQATHSMTEAEIS
ASLEEGLDAGVIEAQEHQMMHNVLALDDRPLTSMMVPRSEVDWLDADATVEAALARLRDD
AGGSTHSWYPVCRGSLDEVLGKISVARLLELGAEAPGTLAKYASEVAFVPETLSGMELLE
QLRLEAGRMVLVVDEYGVVQGLLTPHDLLEAITGELQPASCADAWAVEREDGSWLLDGVM
PVAELKSRLGIDELPLEQRHRYHTLAGFLMATSGHLLATGETVRCGAWQFEVVDLDGRRV
DKVLASRLPTEDAPPS
Download sequence
Identical sequences U5NAQ2
WP_022772125.1.16511 gi|550990772|ref|YP_008681382.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]