SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_022899034.1.36957 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_022899034.1.36957
Domain Number 1 Region: 553-647,688-1061
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 2.13e-22
Family alpha-mannosidase, C-terminal domain 0.048
Further Details:      
 
Domain Number 2 Region: 125-344
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 8.89e-22
Family alpha-mannosidase 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_022899034.1.36957
Sequence length 1063
Comment alpha-mannosidase [Humibacter albus]; AA=GCF_000421825.1; RF=representative genome; TAX=1121952; STAX=427754; NAME=Humibacter albus DSM 18994; strain=DSM 18994; AL=Contig; RT=Major
Sequence
MSSPKLVATRPWDDEDARAGLIDRAVSFEGTIGSTRIAVVPEPLIRTIDGTRAQSVRLIG
RGWPLARRGLRPSLEITGGADLVLAVEDGPAGSIRLLVRAVDEPRSVSVGIPELGSELLE
FELLHQRDWTIHLIHHSHFDFGYTDRQTEVFAAQRSYVDSALDLIDETAGWPDDARFRWN
SEALWAISDWRKQRPEQQMERLVRAVKAGSIGLSALPYNLHTDVCSTDELHELLRDARRL
RDEFGISFTSAMQTDVPGQVAGLPDALQEVGVKYLSVAHNWAGRSQPHTSGGLNLPRLFR
WRSLAGNEVLVWMTDSPHGLAYMEGPMVGFTENIEQVENYLPAYLTAMSTKGYPFPPGVF
GAHGESFEGREPYPWDVLHLRIQGYMGDNAPARLVLPSIVRQWNETWESPRLRVSRNEDF
FADAESRLGDQLVTFEGDWGDWWVEGVGSAAVPVSFMRKAQAEVTDARTISQLSTLAGGE
AVSDESSRSSETYDAISMFNEHTWGAGNSWTHGDEGFSSGELQWQWKVAQSLIAQQRSSE
LLETALVYLGQTVPSADGKGASFAIVNSTGFARSGAVRFLLPEAHVPLDADIALTDARDG
SSVPFVVDEQVNAAHRESGRWVTAHVTGVPAAGYVRVDVRTVDAGRSAPPSENPEDASER
SEYGLLSLSDSGRDEGVDLAERSQAELLSMENEFLRVRVDPRSSTIGSIIEKRTGRELVN
TEAVVGFNGYVYDEYASSGAGFNHLANKLAVSERLEMLATRSLARPLRIVNRYDDAFAQT
LVYEYQAAGVDWVRATLRLPAGSPWLLIENRLSKPARRVKESAYFSFPFAGDAAKMRFEV
SGSVTGDGLPHIPGAPQHMRGVRDWVLIEDGDHAVAWVTKDVPLVEPHTISVPYAPFPSS
TSPREAGTVYSWVHNNIWDTNFPIEQSFEATFTYAVGVRTDKNESGSELALRTAAELVHP
LRAVRATGQSSTAPTHKEILSISDPRVQLIGLVQADDGATIVRVQSFADEPALVGISLAT
ELARAARSTFLGDERGELEVEGSMVYLPLERFEAAAVKVVVDE
Download sequence
Identical sequences WP_022899034.1.36957

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]