SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_023379839.1.72310 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_023379839.1.72310
Domain Number 1 Region: 42-210
Classification Level Classification E-value
Superfamily ClpP/crotonase 1.92e-44
Family Clp protease, ClpP subunit 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_023379839.1.72310
Sequence length 291
Comment peptidase S14 [Pseudomonas sp. VLB120]; AA=GCF_000494915.1; RF=na; TAX=69328; STAX=69328; NAME=Pseudomonas sp. VLB120; strain=VLB120; AL=Complete Genome; RT=Major
Sequence
MTLKTLPAAPAVRPHARVESDLLPKAMERWNPAIKAAAGDDATTITMYDPIGMDWWTGEG
VTAKRVSAALRSIGDKDITVKINSPGGDVFEGLAIYNLLREHKGKVTVQVLGLAASAASF
IAMAGDEIQIARAGFMMIHNAWTIAAGDRNDFTEVAEFLDQIDGTLADIYSVRTGDDIAA
MRALMDVETWMGGSTAVEAGFADGLLPSDAAQEDLQALAPQQIAARRLDTILAKQGMPRS
ERRALIQELKGGTPGAASSGTRTAADNQADLAIHFADLQAAMSRFSAAALK
Download sequence
Identical sequences U5VCP1
WP_023379839.1.72310 gi|557222534|ref|YP_008762749.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]