SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_023380587.1.91273 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_023380587.1.91273
Domain Number 1 Region: 9-257
Classification Level Classification E-value
Superfamily ClpP/crotonase 1.43e-80
Family Crotonase-like 0.000000643
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_023380587.1.91273
Sequence length 257
Comment MULTISPECIES: 2,3-dehydroadipyl-CoA hydratase [Pseudomonas]; AA=GCF_000425785.1; RF=na; TAX=1292030; STAX=470150; NAME=Pseudomonas taiwanensis DSM 21245; strain=DSM 21245; AL=Scaffold; RT=Major
Sequence
MPRYLDVQAPESGVRLITLQRPEALNALCTELLEQLAAELEDAERDEHTQVVVLTGSRKA
FAAGADIREMAERDLVGILNDPRVAHWQRIATFAKPLIAAVNGYALGGGCELVMCSDIVI
AGEDARFGQPEINLGIIPGAGGTQRLLRAVGKPLAMQMVLTGEAIGARHALQAGLVSEIT
QPELTVERALQVARSIAAKAPLAVRLAKEALLKAGDIDLASGLRFERHAFTLLAGTADRD
EGVRAFMEKRPARFTGR
Download sequence
Identical sequences U5VEL4
gi|557223219|ref|YP_008763434.1| WP_023380587.1.72310 WP_023380587.1.91273

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]