SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_023466559.1.79814 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_023466559.1.79814
Domain Number 1 Region: 5-202
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 5.35e-49
Family PP-loop ATPase 0.00021
Further Details:      
 
Domain Number 2 Region: 320-393
Classification Level Classification E-value
Superfamily PheT/TilS domain 0.000000000000146
Family tRNA-Ile-lysidine synthetase, TilS, C-terminal domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_023466559.1.79814
Sequence length 410
Comment tRNA(Ile)-lysidine synthetase [Exiguobacterium sp. MH3]; AA=GCF_000496635.1; RF=na; TAX=1399115; STAX=1399115; NAME=Exiguobacterium sp. MH3; strain=MH3; AL=Complete Genome; RT=Major
Sequence
MEGVPFEPLLVGVSGGCDSMVLVDRLYKEGYDIAIAHVHHGLREASDEEACFIKEWATTR
KISFFMTRLEWTGRTSSQAACREERYAFFERIMEETGRSRLILAHHQDDQIETLLIQLIR
GEAQVDGIPVVRPFGNGWLHRPLLHESKQTLREYALQHEVPWREDASNAETTYLRNQIRH
TIVPSLRDMRPEFEQATAAAAHARQQIMREQAAFVATYLERCKEANGIPVARILELPMDL
QRLVLPTLTGEMFSSDVIRHFVTWLRVDKGSDEVYYGNWRMRRAYGFLMQDRVIRSMNDD
LSFQVGENLGTYHYGEQMVRFSIGNQGIPLDAIAFPLTVRPPRPGDRIQLAVGSKKVSRI
LIDAKVPRYLREQVPVVVDANGVILAVIGHRIAIFGSFELLAKSYLMIEW
Download sequence
Identical sequences WP_023466559.1.79814 gi|557826894|ref|YP_008799308.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]