SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_023974295.1.16915 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_023974295.1.16915
Domain Number - Region: 113-271
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.00602
Family Capz beta-1 subunit 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_023974295.1.16915
Sequence length 319
Comment MULTISPECIES: hypothetical protein [Clostridium]; AA=GCF_000409695.1; RF=na; TAX=1316937; STAX=223919; NAME=Clostridium diolis DSM 15410; strain=DSM 15410; AL=Contig; RT=Major
Sequence
MNSITIPAIKSLSITNKYSDKSLNGDKIIVGTDGNYNYYSYLFWDISSIPTNATVYNAKL
TLFKTDNFYYDTSKKFSISPLYEYFSTYTTYNNSPNYDHYTVINFYPLTDNISVTIDITT
IVSSWVKNSLKNKGIILYGRNEDIFTSFGSVKSSDNYLMPFIIVNYDPYSPNKCLKKECT
NKYSKDCCKKKYNDEYFKDDCCEKYIKICKEELESILFKVCKEACGGNCNPFPSNTSITR
TVRVTGTVAPTSVYYIVVDLQVTRASSGQVNHYYVSDEYDNSLNNTPLPIDKTYNIAVSP
PIQSGDAEDVILYGSYKGF
Download sequence
Identical sequences A0A0K2M8B7
WP_023974295.1.16915 WP_023974295.1.95078

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]