SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_024082485.1.57566 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_024082485.1.57566
Domain Number 1 Region: 256-401
Classification Level Classification E-value
Superfamily Ferredoxin reductase-like, C-terminal NADP-linked domain 3.14e-37
Family Aromatic dioxygenase reductase-like 0.036
Further Details:      
 
Domain Number 2 Region: 105-270
Classification Level Classification E-value
Superfamily Riboflavin synthase domain-like 3.08e-36
Family Ferredoxin reductase FAD-binding domain-like 0.0058
Further Details:      
 
Domain Number 3 Region: 39-124
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 2.14e-23
Family 2Fe-2S ferredoxin domains from multidomain proteins 0.085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_024082485.1.57566
Sequence length 406
Comment MULTISPECIES: NADH:ubiquinone reductase (Na(+)-transporting) subunit F [Pseudomonas]; AA=GCF_002216425.1; RF=na; TAX=287; STAX=287; NAME=Pseudomonas aeruginosa; strain=Pae100; AL=Contig; RT=Major
Sequence
MGFEIFLAIGMFTAIVLGLVAIILVARAKLVSSGDVTIQINGEHSLTVPAGGKLLQTLAA
NNVFLSSACGGGGTCAQCKCVVVEGGGEMLPTEESHFTRRQAKEGWRLSCQTPVKQDMQI
RVPEEVFGVKKWECTVESNPNVATFIKELTLRLPDGESVDFRAGGYVQLECPPHVVEYKD
FDIQSEYRGDWDKFNMWRYVSKVDETVIRAYSMANYPEEKGVVKFNIRIASPPPGSDLPP
GQMSSWVFNLKPGDKVTVYGPFGEFFAKDTEAEMVFIGGGAGMAPMRSHIFDQLRRLKSN
RKISFWYGARSLREAFYTEEYDQLQAENPNFQWHLALSDPQPEDNWTGLTGFIHNVLFEN
YLKDHPAPEDCEFYMCGPPMMNAAVIKMLTDLGVERENILLDDFGG
Download sequence
Identical sequences A0A1E9CKJ7 A0A1F0J7B2 A0A225KU85
gi|568153208|ref|YP_008942169.1| WP_024082485.1.1109 WP_024082485.1.1238 WP_024082485.1.25179 WP_024082485.1.28528 WP_024082485.1.28838 WP_024082485.1.32869 WP_024082485.1.34836 WP_024082485.1.40994 WP_024082485.1.42952 WP_024082485.1.48334 WP_024082485.1.48378 WP_024082485.1.48961 WP_024082485.1.49135 WP_024082485.1.49500 WP_024082485.1.53948 WP_024082485.1.57566 WP_024082485.1.59099 WP_024082485.1.60206 WP_024082485.1.63057 WP_024082485.1.66931 WP_024082485.1.72541 WP_024082485.1.73149 WP_024082485.1.75041 WP_024082485.1.7779 WP_024082485.1.82334 WP_024082485.1.87530 WP_024082485.1.92321 WP_024082485.1.93250 WP_024082485.1.94896 WP_024082485.1.96357 WP_024082485.1.96967 WP_024082485.1.99214

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]