SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_024086451.1.65739 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_024086451.1.65739
Domain Number 1 Region: 3-179
Classification Level Classification E-value
Superfamily Phosphoglucomutase, first 3 domains 1.37e-35
Family Phosphoglucomutase, first 3 domains 0.00009
Further Details:      
 
Domain Number 2 Region: 260-365
Classification Level Classification E-value
Superfamily Phosphoglucomutase, first 3 domains 1.37e-31
Family Phosphoglucomutase, first 3 domains 0.00075
Further Details:      
 
Domain Number 3 Region: 155-258
Classification Level Classification E-value
Superfamily Phosphoglucomutase, first 3 domains 8.63e-29
Family Phosphoglucomutase, first 3 domains 0.00059
Further Details:      
 
Domain Number 4 Region: 370-453
Classification Level Classification E-value
Superfamily Phosphoglucomutase, C-terminal domain 9.77e-19
Family Phosphoglucomutase, C-terminal domain 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_024086451.1.65739
Sequence length 453
Comment MULTISPECIES: phosphomannomutase/phosphoglucomutase [Pseudomonas putida group]; AA=GCF_001027965.1; RF=na; TAX=303; STAX=303; NAME=Pseudomonas putida; strain=SF1; AL=Contig; RT=Major
Sequence
MYAPIQTRCFKAYDIRGQVPADLNDDIAYRIGRALVAELGGKCYVVGRDMRLESPGLSRA
LMKGLTEGGAEVIDIGLCGTEEVYFATSHYQADGGIMVTASHNPKGYNGMKLVREQSRPI
SGDTGLNDIRQRVEAGNLGTPGITPGVVREAFDKSAYIDHLLTYVDVSALKPLKVLADPG
NGAVGPVLELLKARLPLDITIINGEPDGNFPNGIPNPLLPENRDLTRQAVLDTGADMGIA
FDGDFDRCFFFDNQGRFIEGYYVVGLLAEMLLAKNPGSKIIHDPRLTWNTIEQVEAAGGI
AIQSKTGHAFIKERMRAEDAVYGGEMSAHHYFRDFAYCDSGNIPWLLVAELMSTTGKSLA
QLVDERIAAFPCSGEINYEVADVKATIENILAFYLPHNPEVDRTDGISVAFADWRFSLRG
SNTEPLLRLNVESRADSTLVERRVNEIARLIRS
Download sequence
Identical sequences V9UWJ5
WP_024086451.1.23948 WP_024086451.1.28354 WP_024086451.1.65739 gi|568186270|ref|YP_008958796.1| gi|568180839|ref|YP_008953367.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]