SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_024086539.1.28354 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_024086539.1.28354
Domain Number 1 Region: 1-101
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.65e-21
Family Glutathione S-transferase (GST), N-terminal domain 0.0079
Further Details:      
 
Domain Number 2 Region: 82-195
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 3.21e-20
Family Glutathione S-transferase (GST), C-terminal domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_024086539.1.28354
Sequence length 197
Comment MULTISPECIES: glutathione S-transferase [Pseudomonas putida group]; AA=GCF_000510325.1; RF=na; TAX=1435058; STAX=76759; NAME=Pseudomonas monteilii SB3101; strain=SB3101; AL=Complete Genome; RT=Major
Sequence
MILYSFRRCPWAMRARLALRYAECKVEIREVAMKNKPAELLALSPKGTVPVLDTGAGVLE
ESLDIMRWALAQNDPQDWRLQADPAAAQQAETLIARNDSTFKAQANLYKYAERYPEHTRE
HYRQQAEAWLAELEGLLAGRPYLLATHPSIADAALLPLMRQFAGVEPQWFAEAAYPRVRS
WLEGWLASELFRSVMAK
Download sequence
Identical sequences A0A059UTS1 A0A0B5KH32 V9UZG6
gi|568181027|ref|YP_008953561.1| WP_024086539.1.23948 WP_024086539.1.28354 WP_024086539.1.35335 WP_024086539.1.80759 gi|568186458|ref|YP_008958990.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]