SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_024086674.1.80759 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_024086674.1.80759
Domain Number 1 Region: 3-331
Classification Level Classification E-value
Superfamily ABC transporter involved in vitamin B12 uptake, BtuC 3.01e-76
Family ABC transporter involved in vitamin B12 uptake, BtuC 0.00000224
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_024086674.1.80759
Sequence length 338
Comment MULTISPECIES: ABC transporter permease [Pseudomonas putida group]; AA=GCF_000831585.1; RF=na; TAX=70775; STAX=70775; NAME=Pseudomonas plecoglossicida; strain=NyZ12; AL=Complete Genome; RT=Major
Sequence
MMRLLPCIAVALAALLAALLAGTAIGETNLSPGVVGQVLANQLWQAGYPVDPIDAGIVWN
YRLPRTLVAAACGAGLATCGVILQALLRNPLAEPYLLGLSAGASTGAVLVGLLGFGSLAL
SMSGGAFIGALAAFALVLLLARAAGPSSNNAQVILAGIAGSQLFNALTAFLITMSATAEQ
ARGILFWLLGNLSGVRWPSVWLAVPVVLFGLLVCLWHRRALDAFTFGADSAASLGIPVRR
TQLLLISCAALVTAVMVSIVGAIGFVGLVIPHALRLLLGPGHSRLLPASALGGALFLIAA
DILSRILIPGQVIPVGVVTALLGAPVFALILVSRRGRP
Download sequence
Identical sequences A0A059UW14 A0A099MX43 V9UVT0
gi|568181386|ref|YP_008953931.1| gi|568186817|ref|YP_008959360.1| WP_024086674.1.23948 WP_024086674.1.28354 WP_024086674.1.35335 WP_024086674.1.65739 WP_024086674.1.7288 WP_024086674.1.80759

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]