SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_024086921.1.23948 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_024086921.1.23948
Domain Number 1 Region: 8-189,258-335
Classification Level Classification E-value
Superfamily ClpP/crotonase 2.81e-64
Family Crotonase-like 0.00026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_024086921.1.23948
Sequence length 355
Comment crotonase [Pseudomonas monteilii]; AA=GCF_000510285.1; RF=na; TAX=1435044; STAX=76759; NAME=Pseudomonas monteilii SB3078; strain=SB3078; AL=Complete Genome; RT=Major
Sequence
MSDTEVPVLAEVRNRVGHLALNRPVGLNALTLQMIRITWRQLHAWESDPEIVAVVLRANG
EKAFCAGGDIRSLYDSYQAGDDLHHVFLEEKYSLDQYIHGYPKPIVALMDGFVLGGGMGL
VQGTALRVVTERVKMGMPETSIGYFPDVGGSNFLPRLPGELGLYLGITGIQIRAADALYA
RLADWCLPSERISEFDRRLDQISWGYAPREILAGLLSSLASNRLLGAELKSLHPAIDEHF
TQPDLSAIRASLQAERRPEYQDWAEQTVELLNNRSPLAMSATLKLLRLGRTLSLANCFEL
ELHLERQWFAKGDLIEGVRALLIDKDKTPRWNPPTLEQLDTNRVNEFFDGFQPAT
Download sequence
Identical sequences V9UZJ0
gi|568181925|ref|YP_008954497.1| WP_024086921.1.23948 WP_024086921.1.28354 gi|568187305|ref|YP_008959867.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]