SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_024087236.1.28354 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_024087236.1.28354
Domain Number 1 Region: 8-199,268-338
Classification Level Classification E-value
Superfamily ClpP/crotonase 1.05e-72
Family Crotonase-like 0.0000947
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_024087236.1.28354
Sequence length 356
Comment MULTISPECIES: crotonase [Pseudomonas putida group]; AA=GCF_000510325.1; RF=na; TAX=1435058; STAX=76759; NAME=Pseudomonas monteilii SB3101; strain=SB3101; AL=Complete Genome; RT=Major
Sequence
MTAHAHTSATDHVLAEVRNQIGHLTLNRPAGLNALTLDMVRSLRQHLDQWAEDPHVHAVV
LRGEGPKGFCAGGDIRSLHDSFKAGDTLHETFFVEEYALDLAIHRYRKPVLVLMDGFTLG
GGMGLAQGCDLRVVTERSRLGMPEVAIGYFPDVGGSYFLSRIPGELGIYLGVSGSQIQAA
DALYCGLADWYLASDQLAALDQGLDQLRFGDQPLKDLQNLLAKLGTQVLDDAPLEKLRPV
IDHFFALTDVPAMVEQLRAVSIGDSHAWAVATADQLESRSPLAMAVTLEMLRRGRHLSLD
DCFAMELHLDRQWFQHGDIIEGVRALIIDKDKQPRWNPPTLAALQRQRVDQFFEGL
Download sequence
Identical sequences V9V268
gi|568187901|ref|YP_008960519.1| WP_024087236.1.23948 WP_024087236.1.28354 WP_024087236.1.7288 gi|568182523|ref|YP_008955151.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]