SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_024087334.1.35335 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_024087334.1.35335
Domain Number 1 Region: 13-174
Classification Level Classification E-value
Superfamily FAD-binding/transporter-associated domain-like 7.01e-33
Family FAD-linked oxidases, N-terminal domain 0.013
Further Details:      
 
Domain Number 2 Region: 137-349
Classification Level Classification E-value
Superfamily FAD-linked oxidases, C-terminal domain 2.09e-19
Family Vanillyl-alcohol oxidase-like 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_024087334.1.35335
Sequence length 350
Comment MULTISPECIES: glycolate oxidase subunit GlcE [Pseudomonas putida group]; AA=GCF_000691565.1; RF=na; TAX=303; STAX=303; NAME=Pseudomonas putida; strain=DLL-E4; AL=Complete Genome; RT=Major
Sequence
MSMDRDISQALLEQVNQALNQATPLRIQGGNSKAMLGCPVAGEVLDTRSHRGIVSYDPTE
LVLTARAGTPLREIEAALHEAGQMLPCEPPHLGPDATLGGMVAAGLSGPRRPWAGSVRDY
VLGTRVITGHGKLLRFGGEVMKNVAGYDVSRLMAGSFGCLGLLTEVSLKVLPRPRQCLSL
RLPMGRHQALAELAEWGQQPLPISAACHDGDALYLRLEGGEGSVQSARQRLGGEALDSSF
WSDLREQRLAFFTGPAPLWRLSVPNTTGELDLPGQQLIDWGGAQRWLKSTAPAQHIREQV
AKVGGHATCHVPGAASSPPLPAALMRYHRALKQQLDPQGVFNPGRLYPDL
Download sequence
Identical sequences A0A059UYE8 V9V181
WP_024087334.1.23948 WP_024087334.1.28354 WP_024087334.1.35335 WP_024087334.1.65739 WP_024087334.1.7288 gi|568182756|ref|YP_008955393.1| gi|568188134|ref|YP_008960761.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]