SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_024087525.1.91585 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_024087525.1.91585
Domain Number 1 Region: 26-93
Classification Level Classification E-value
Superfamily Homeodomain-like 2.19e-16
Family Tetracyclin repressor-like, N-terminal domain 0.0071
Further Details:      
 
Domain Number 2 Region: 100-218
Classification Level Classification E-value
Superfamily Tetracyclin repressor-like, C-terminal domain 0.00000171
Family Tetracyclin repressor-like, C-terminal domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_024087525.1.91585
Sequence length 224
Comment MULTISPECIES: transcription regulator protein [Pseudomonas]; AA=GCF_000793845.1; RF=na; TAX=287; STAX=287; NAME=Pseudomonas aeruginosa; strain=AZPAE14913; AL=Scaffold; RT=Major
Sequence
MTTSSARSKASTPSKHPSSVGGAVQSEKARLVLAGARTVFLANGFSAATTDMIQQAAGVS
KSTVYSHYPNKEALFVAVVEAECERFLRAVRKPKFPEERLADILNAMALAYLEIVLSRDG
LALYRMIAAEAPRFPELGRRFYLAGPAAINNIVAETLEVAASKGELDLGSIGLDSAASLF
VNMVRGEAQMQCVMHPDAPASAAQRDRWAKDAVTTFMRAYGRDR
Download sequence
Identical sequences V9V176
gi|568183339|ref|YP_008956005.1| gi|568188712|ref|YP_008961368.1| WP_024087525.1.13208 WP_024087525.1.15328 WP_024087525.1.1761 WP_024087525.1.19930 WP_024087525.1.23948 WP_024087525.1.26862 WP_024087525.1.28354 WP_024087525.1.51472 WP_024087525.1.91585 WP_024087525.1.95207

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]