SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_024087803.1.28354 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_024087803.1.28354
Domain Number 1 Region: 85-193
Classification Level Classification E-value
Superfamily ARM repeat 0.00000153
Family PBS lyase HEAT-like repeat 0.081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_024087803.1.28354
Sequence length 495
Comment MULTISPECIES: branched-chain amino acid ABC transporter permease [Pseudomonas putida group]; AA=GCF_000510325.1; RF=na; TAX=1435058; STAX=76759; NAME=Pseudomonas monteilii SB3101; strain=SB3101; AL=Complete Genome; RT=Major
Sequence
MLRLLLTLLLLMPLATQASEGEFFLAAKPAEQARLLEGWAAQPDTARLALLDNLRQGRIA
ADDTRKVRLNNRLRGLIDNALASHQLLSDNSDIRLAAAQQLQKSAQPAQMAFLDRRFASE
PDAAVHAALGLALANLQLGASEPAVRLAAVRLLGETGDPLARTRLEALLQPNAETDPGVR
TAAETSLAQVQRKLLAGELLGQAFSGLSLGSILLLAALGLAITFGLLGVINMAHGEMLML
GAYSTYMVQVLLQRYAPGAIEFYPLIALPVAFAISAGVGMALERTVIRHLYGRPLETLLA
TWGISLILIQAIRLLFGAQNVEVSNPAWLSGGIQLLPNLVLPYNRLVIIGFALAVVLLTW
LLLNRTRLGLNVRAVTQNRNMAACCGVSTGRVDMLAFGLGSGIAGLGGVALSQVGNVGPD
LGQSYIIDSFLVVVLGGVGQLAGSLWAAFGLGIANKLLEPQIGAVLGKILILALIILFIQ
KRPQGLFALKGRVID
Download sequence
Identical sequences A0A2A3MBE2 V9V8D3
gi|568184200|ref|YP_008956892.1| WP_024087803.1.23948 WP_024087803.1.28354 WP_024087803.1.35335 WP_024087803.1.56258 WP_024087803.1.65739 WP_024087803.1.7288 WP_024087803.1.80759 gi|568189573|ref|YP_008962255.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]