SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_024124406.1.87165 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_024124406.1.87165
Domain Number 1 Region: 2-186
Classification Level Classification E-value
Superfamily ITPase-like 7.85e-58
Family Maf-like 0.0000796
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_024124406.1.87165
Sequence length 198
Comment septum formation inhibitor Maf [Thermosynechococcus sp. NK55a]; AA=GCF_000505665.1; RF=na; TAX=1394889; STAX=1394889; NAME=Thermosynechococcus sp. NK55a; strain=NK55; AL=Chromosome; RT=Major
Sequence
MVPFVLASASPARRQLLQQIGIDPIIQPSHFDESVIQATTPTELVRLLARCKAETVAQSY
SAPALILGCDSVLVLGGEIYGKPASPEMAIARWQKMRGQTGDLLTGHALIDLAQGRTCVE
VESTQVVFADISDAEIAAYVASGEPLACAGCFALDGQGGAFVEKIVGTPSNVIGLSLPLL
RRLLLKLGYTLGDVQSKK
Download sequence
Identical sequences V5V3N6
WP_024124406.1.87165 gi|571027390|ref|YP_008899508.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]