SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_024900263.1.22424 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_024900263.1.22424
Domain Number 1 Region: 12-179,269-385
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.92e-50
Family FAD-linked reductases, N-terminal domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_024900263.1.22424
Sequence length 414
Comment 2-octaprenyl-6-methoxyphenyl hydroxylase [Ochrobactrum rhizosphaerae]; AA=GCF_000559065.1; RF=na; TAX=1437448; STAX=571254; NAME=Ochrobactrum rhizosphaerae SJY1; strain=SJY1; AL=Contig; RT=Major
Sequence
MNDVVVDKPLTEIVISGGGPAGMMAALALSAKGYRTALLGPETDKNDRRTTALMMPAIRF
LEEIGVWGDIAPEAAPLASMRIVDATHRLIRSPAVTFRAGEIDEVAFGYNIPNAALNQKL
AEAVEKNSAIERITLPAIEYRNNDDHVTITLKGGDTLHTRLVVAADGRNSAAREAAGIRT
RRWSYPQTAVVLSFSHTVDHENISTEFHTEEGPFTQVPLKGKRSSLVWVVNPGRAETLLA
LDDETLGQRIEEMMQSMLGKVTLDIRPQAWPLSGLVPHAFAAKRTVLIGEAAHVFPPIGA
QGLNLGTRDVETLVKAITSDPSDPGSDRVTRAYDRGRRPDILARTGSVDALNRSLLSPML
PAQIARGVGLEMLRSFAPLRAFFMREGLRPGSGFSQFMPKLPSLAERGKTSPKQ
Download sequence
Identical sequences CJA20515 WP_024900263.1.22424 281687.CJA20515

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]