SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_024935418.1.68640 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_024935418.1.68640
Domain Number 1 Region: 117-315
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 7.23e-21
Family alpha-mannosidase 0.06
Further Details:      
 
Domain Number 2 Region: 593-1054
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 2.54e-19
Family 4-alpha-glucanotransferase, C-terminal domain 0.097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_024935418.1.68640
Sequence length 1056
Comment hypothetical protein [Actinomadura madurae]; AA=GCF_000468475.2; RF=na; TAX=1394178; STAX=1993; NAME=Actinomadura madurae LIID-AJ290; strain=LIID-AJ290; AL=Contig; RT=Major
Sequence
MTSRLLQASLGSPDYDGIRAALREDTSAEVLAVRGLSVRAAVLPLFKRDGDGALRQAVRL
TLSGGGRIDVALKDGDAVLASATGEGETLTLLVPEVDGTRRVTLEVRDANGLVGAAPLDI
TPQRKWNVFVVHHSHLDIGYTDTQGTVLRHHLDYLDAALRLARETDGRPDDARFRWSVES
SMPALRWLATRSDDQVAEFTERVRAGNIEVTAFPMQLHTEACSTEELYRQLRFVEDLRHK
YGIEVRSAMHTDIPGAVAGTVDALNAAGVRYLAAAHNWAGRSVPYITGGDRLARPFRWRS
PGGGELLVWFTDTPHGMAYMEGNTVGLVDGYDLAEDLLPRYLGTLADRPYPYGPGTFGWY
AAPGQVGAAKDPDFLDAVHLRVQGAHADNAGPSIVPADIAHRWNATWAYPRLRMATNADF
FDYVEEHHGDRLQVHEGDWTDWWADGLGSGARPLGYVRRAQNILRSAETLHALADERSGL
LWGDDPPHPPEGPATAAPSAPLALRSRSRSGDRTGASEAVDAAYDLAALFDEHTWGAANP
WEDAEEGTDSGGLQWTRKSQVGYQAHDDALDLLQAGARRLGDTFGAAPDALASFLVVNPG
TAARTDVARAFLPRDVVAVDVPITLVDARTGEPVPHREEEVDPDEWPTRPIGRHLEAVLP
DVLGHGHVRVDVVRSAERAPEPVDLGTEGTIENEFYRVTYDLKEGHIGSVFDKTAGRELV
NADAAAGFGQYVYDRYATAPHFNHMSGHMLVHDKTMLGDRAIATHATVTRCERTPAGERL
VVELHGKGVDWLRTTIDLYAGVPRVDVRYQLGKQPTAAKEAVFFAFPFAVDGPPAAWELT
GGVGGTAVPSVPGSAEHMRPIRHWVAFEDPDITVAWATLEAPLVQFGSIHMPYAPFPPTL
DNEDGTVYSWALNNIWDTNFPSQQQGETTFRYAFASAAAGSGRRLGARTAAGLTDPFVAT
LATGTASPAASGTFLRVDDPDVLVTSVGRARDGDGLAVRLQSLASGAVETDLHMPGVTSA
RLSGGLERDPADLPVRDGTMTVRLPACGVATVTVRR
Download sequence
Identical sequences WP_024935418.1.68640

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]